Product Name: KCNJ1 / ROMK antibody
Applications: ICC/IF, IHC, IP, WB
Predicted Target Size:
Positive Controls:
Form Supplied: Liquid
Concentration:
Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST, and then the antibody was affinity purified on immobilized Kir1.1-GST.
Full Name: potassium inwardly-rectifying channel, subfamily J, member 1
Background: potassium channel involved in K+ secretion in the renal distal nephron [RGD, Feb 2006]
Synonyms: potassium inwardly-rectifying channel, subfamily J, member 1 Antibody , Kcnj1 Antibody , ROMK1 Antibody , Kcnj Antibody
Cellular Localization:
CAS NO: 1405-37-4
Product: Rufloxacin (hydrochloride)
Host: Rabbit
Clonality: Polyclonal
Isotype:
Immunogen: GST fusion protein with sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat ROMK (Accession P35560), (MW: 33 kDa). Intracellular, C-terminus.
Antigen Species: Rat
Species Reactivity: Human, Mouse, Rat
Conjugation: Unconjugated
Storage Buffer: Phosphate buffered saline (PBS), pH 7.4, 1% BSA and 0.025% NaN3.
Storage Instruction: Keep as concentrated solution. Aliquot and store at -20ÂșC or below. Avoid multiple freeze-thaw cycles.
Notes: For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.
Specificity:
PubMed ID:http://www.ncbi.nlm.nih.gov/pubmed/23569323?dopt=Abstract
