Product Name: Kv1.3 antibody
Applications: ICC/IF, IHC, IP, WB
Predicted Target Size:
Positive Controls:
Form Supplied: Liquid
Concentration:
Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and from antibodies cross-reactive to other Kv1 by affinity chromatography on immobilized Kv1.1-GST-fusion protein. The antibody was then affinity purified on immo
Full Name: potassium voltage-gated channel, shaker-related subfamily, member 3
Background: Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes – shaker, shaw, shab, and shal – have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1
Synonyms: potassium voltage-gated channel, shaker-related subfamily, member 3 Antibody , PCN3 Antibody , HGK5 Antibody , HUKIII Antibody , HLK3 Antibody , HPCN3 Antibody , MK3 Antibody , KCNA3 Antibody , KV1.3 Antibody
Cellular Localization:
CAS NO: 25332-39-2
Product: Irbinitinib
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Immunogen: GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human Kv1.3 (Accession P22001). Intracellular, C-terminus.
Antigen Species: Human
Species Reactivity: Human, Mouse, Rat
Conjugation: Unconjugated
Storage Buffer: Phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN3.
Storage Instruction: Keep as concentrated solution. Aliquot and store at -20ÂșC or below. Avoid multiple freeze-thaw cycles.
Notes: For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.
Specificity:
PubMed ID:http://www.ncbi.nlm.nih.gov/pubmed/19322782?dopt=Abstract
