Product Name: Kv1.4 antibody
Applications: ICC/IF, IHC, WB
Predicted Target Size:
Positive Controls:
Form Supplied: Liquid
Concentration:
Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and on possible cross-reactive antibodies to other Kv1 on immobilized homologous region of KV1.1-GST, and then the antibody was affinity purified on immobilized KV
Full Name: potassium voltage-gated channel, shaker-related subfamily, member 4
Background: voltage-gated K+ channel; responsible for potassium permeability in excitable membranes [RGD, Feb 2006]
Synonyms: potassium voltage-gated channel, shaker-related subfamily, member 4 Antibody , Kv4 Antibody , Kcna4 Antibody , KCHAN Antibody , RK3 Antibody , RHK1 Antibody
Cellular Localization:
CAS NO: 1218-35-5
Product: VBY-825
Host: Rabbit
Clonality: Polyclonal
Isotype:
Immunogen: GST fusion protein with sequence PYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEE KCQGKGDDSETDKNNCSNAKAVETDV, corresponding to amino acid residues 589-655 of rat KV1.4 (Accession P15385). Intracellular, C-terminus.
Antigen Species: Rat
Species Reactivity: Human, Mouse, Rat
Conjugation: Unconjugated
Storage Buffer: Phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose and 0.025% NaN3.
Storage Instruction: Keep as concentrated solution. Aliquot and store at -20ÂșC or below. Avoid multiple freeze-thaw cycles.
Notes: For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.
Specificity:
PubMed ID:http://www.ncbi.nlm.nih.gov/pubmed/19286132?dopt=Abstract