Product Name: Kv1.6 antibody
Applications: ICC/IF, IHC, WB
Predicted Target Size:
Positive Controls:
Form Supplied: Liquid
Concentration:
Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and from antibodies cross-reactive to other Kv1 by affinity chromatography on immobilized Kv1.1-GST and Kv1.4-GST, and then the antibody was affinity purified on i
Full Name: potassium voltage gated channel, shaker related subfamily, member 6
Background:
Synonyms: Kcna6 Antibody , potassium voltage gated channel, shaker related subfamily, member 6 Antibody
Cellular Localization:
CAS NO: 3810-74-0
Product: AM251
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Immunogen: GST fusion protein with a sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEAS RERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463-530 of rat Kv1.6 (Accession P17659), (MW: 35 kDa.). Intracellular, C-terminus.
Antigen Species: Rat
Species Reactivity: Mouse, Rat
Conjugation: Unconjugated
Storage Buffer: Reconstituted antibody containsA?phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN3.
Storage Instruction: Keep as concentrated solution. Aliquot and store at -20oC or below. Avoid multiple freeze-thaw cycles.
Notes: For In vitro laboratory use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.
Specificity:
PubMed ID:http://www.ncbi.nlm.nih.gov/pubmed/17203973?dopt=Abstract
